5-letter K- words

5-letter words starting with K

Every 5-letter English word that begins with the letter K — 206 entries from the Scrabble-standard ENABLE word list. Useful when you need a Wordle starter beginning with K, an anagram answer, or a crossword fill.

The full list

206 words

KABABKABARKABOBKADISKAFIRKAGUSKAIAKKAIFSKAILSKAINSKAKASKAKISKALAMKALESKALIFKALPAKAMESKAMIKKANASKANESKANJIKAONSKAPASKAPHSKAPOKKAPPAKAPUTKARATKARMAKARNSKAROOKARSTKARTSKASHAKATASKAURIKAURYKAVASKAYAKKAYOSKAZOOKBARSKEBABKEBARKEBOBKECKSKEDGEKEEFSKEEKSKEELSKEENSKEEPSKEETSKEEVEKEFIRKEIRSKELEPKELIMKELLYKELPSKELPYKEMPSKEMPTKENAFKENCHKENDOKENOSKEPISKERBSKERFSKERNEKERNSKERRYKETCHKETOLKEVELKEVILKEXESKEYEDKHADIKHAFSKHAKIKHANSKHAPHKHATSKHEDAKHETHKHETSKHOUMKIANGKIBBEKIBBIKIBEIKIBESKIBLAKICKSKICKYKIDDOKIDDYKIEFSKIERSKIKESKILIMKILLSKILNSKILOSKILTSKILTYKINASKINDSKINESKINGSKININKINKSKINKYKINOSKIOSKKIRKSKIRNSKISSYKISTSKITEDKITERKITESKITHEKITHSKITTYKIVASKIWISKLONGKLOOFKLUGEKLUTZKNACKKNAPSKNARSKNAURKNAVEKNEADKNEEDKNEELKNEESKNELLKNELTKNIFEKNISHKNITSKNOBSKNOCKKNOLLKNOPSKNOSPKNOTSKNOUTKNOWNKNOWSKNURLKNURSKOALAKOANSKOELSKOHLSKOINEKOLASKOLOSKONKSKOOKSKOOKYKOPEKKOPHSKOPJEKOPPAKORAIKORATKORUNKOTOSKOTOWKRAALKRAFTKRAITKRAUTKREEPKRILLKRONAKRONEKROONKRUBIKUDOSKUDUSKUDZUKUGELKUKRIKULAKKUMYSKURTAKURUSKUSSOKVASSKYACKKYAKSKYARSKYATSKYLIXKYRIEKYTESKYTHE

About this list

This list is drawn from the ENABLE word list — the Enhanced North American Benchmark LExicon, a 173,000-word public-domain dictionary that is the de-facto standard for North American word games (Scrabble Tournament Word List, Words With Friends, etc.). Puzzle Cottage’s dictionary uses the 1–8 letter subset (~80,000 words) for word-validation in Word Scramble and Anagram Race.

Words flagged as predominantly proper nouns (HARRY, PETER, JIMMY, etc.) are filtered out — technically valid in Scrabble, but most players read them as names and feel cheated when they’re accepted in word games. Common nouns that double as names (HOLLY, DOLLY, PENNY) stay.

Frequently asked questions

How many 5-letter words start with K?
206 according to the ENABLE word list (proper-noun-leaning entries excluded).
Are these all valid Wordle answers?
These are valid Wordle guesses (5-letter ENABLE words). Wordle's actual answers are a curated subset — about 2,315 of the most common 5-letter words.
What's a good Wordle starter beginning with K?
For optimal entropy, see our best Wordle starting words guide. Among K-starters, the most-frequent letter combinations win — words containing E, A, R, O, T tend to score higher.
Can I use these in Scrabble?
Yes — ENABLE was the Scrabble Tournament Word List for years. All entries here are valid Scrabble plays.
Where does the list come from?
The ENABLE (Enhanced North American Benchmark LExicon) word list — public domain, ~173,000 words total, used as the standard for North American word games.